Sign Up

Sign Up to our social questions and Answers Engine to ask questions, answer people’s questions, and connect with other people.

Have an account? Sign In

Have an account? Sign In Now

Sign In

Login to our social questions & Answers Engine to ask questions answer people’s questions & connect with other people.

Sign Up Here

Forgot Password?

Don't have account, Sign Up Here

Forgot Password

Lost your password? Please enter your email address. You will receive a link and will create a new password via email.

Have an account? Sign In Now

You must login to ask a question.

Forgot Password?

Need An Account, Sign Up Here

Please briefly explain why you feel this question should be reported.

Please briefly explain why you feel this answer should be reported.

Please briefly explain why you feel this user should be reported.

Sign InSign Up

The Archive Base

The Archive Base Logo The Archive Base Logo

The Archive Base Navigation

  • Home
  • SEARCH
  • About Us
  • Blog
  • Contact Us
Search
Ask A Question

Mobile menu

Close
Ask a Question
  • Home
  • Add group
  • Groups page
  • Feed
  • User Profile
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Buy Points
  • Users
  • Help
  • Buy Theme
  • SEARCH
Home/ Questions/Q 870555
In Process

The Archive Base Latest Questions

Editorial Team
  • 0
Editorial Team
Asked: May 15, 20262026-05-15T10:29:48+00:00 2026-05-15T10:29:48+00:00

I have a FASTA file containing several protein sequences. The format is like ———————-

  • 0

I have a FASTA file containing several protein sequences. The format is like

----------------------
>protein1
MYRALRLLARSRPLVRAPAAALASAPGLGGAAVPSFWPPNAAR
MASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTE
RMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAE
GKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSK
IPVHPNDHVNKSQ

>protein2
MRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLDSRP
LPAWFDEAKFGVFIHWGVFSVPAWGSEWFWWHWQGEGRPYQRF
MRDNYPPGFSYADFGPQFTARFFHPEEWADLFQAAGAKYVVLT
TKHHEGFTNW*

>protein3
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGF
CHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKF
SNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTY`

-----------------------------------

Is there a good way to read in this file and store the sequences separately?

Thanks

  • 1 1 Answer
  • 0 Views
  • 0 Followers
  • 0
Share
  • Facebook
  • Report

Leave an answer
Cancel reply

You must login to add an answer.

Forgot Password?

Need An Account, Sign Up Here

1 Answer

  • Voted
  • Oldest
  • Recent
  • Random
  1. Editorial Team
    Editorial Team
    2026-05-15T10:29:49+00:00Added an answer on May 15, 2026 at 10:29 am

    I think maybe a little more detail about the exact file structure could be helpful. Just looking at what you have (and a quick peek at the samples on wikipedia) suggest that the name of the protein is prepended with a >, followed by at least one line break, so that would be a good place to start.

    You could split the file on newline, and look for a > character to determine the name.

    From there it is a little less clear because I’m not sure if the sequence data is all in one line (no linebreaks) or if it could have linebreaks. If there are none, then you should be able to just store that sequence information, and move on to the next protein name. Something like this:

    var reader = new StreamReader("C:\myfile.fasta");
    while(true)
    {
        var line = reader.ReadLine();
        if(string.IsNullOrEmpty(line))
            break;
        if(line.StartsWith(">"))
            StoreProteinName(line);
        else
            StoreSequence(line);
    }
    

    If it were me, I would probably use TDD and some sample data to build out a simple parser, and then keep plugging in samples until I felt I had covered all of major variances in the format.

    • 0
    • Reply
    • Share
      Share
      • Share on Facebook
      • Share on Twitter
      • Share on LinkedIn
      • Share on WhatsApp
      • Report

Sidebar

Related Questions

I have a file format (fastq format) that encodes a string of integers as
I have memory mapped a large formatted (text) file containing one integer per line
I have got a map defined inside a class in header file like this:
Currently I have some code to replace strings in a file that looks like
I have a table that looks something like this: word big expensive smart fast
-- I just parsed a big file and I created a list containing 42.000
I have a number of MP3 files containing lectures where the speaker talks very
I have a binary file, where are a few values what should be changed.
I have several USB mass storage flash drives connected to a Ubuntu Linux computer
I have a snippet to create a 'Like' button for our news site: <iframe

Explore

  • Home
  • Add group
  • Groups page
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Users
  • Help
  • SEARCH

Footer

© 2021 The Archive Base. All Rights Reserved
With Love by The Archive Base

Insert/edit link

Enter the destination URL

Or link to existing content

    No search term specified. Showing recent items. Search or use up and down arrow keys to select an item.