Sign Up

Sign Up to our social questions and Answers Engine to ask questions, answer people’s questions, and connect with other people.

Have an account? Sign In

Have an account? Sign In Now

Sign In

Login to our social questions & Answers Engine to ask questions answer people’s questions & connect with other people.

Sign Up Here

Forgot Password?

Don't have account, Sign Up Here

Forgot Password

Lost your password? Please enter your email address. You will receive a link and will create a new password via email.

Have an account? Sign In Now

You must login to ask a question.

Forgot Password?

Need An Account, Sign Up Here

Please briefly explain why you feel this question should be reported.

Please briefly explain why you feel this answer should be reported.

Please briefly explain why you feel this user should be reported.

Sign InSign Up

The Archive Base

The Archive Base Logo The Archive Base Logo

The Archive Base Navigation

  • SEARCH
  • Home
  • About Us
  • Blog
  • Contact Us
Search
Ask A Question

Mobile menu

Close
Ask a Question
  • Home
  • Add group
  • Groups page
  • Feed
  • User Profile
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Buy Points
  • Users
  • Help
  • Buy Theme
  • SEARCH
Home/ Questions/Q 6095097
In Process

The Archive Base Latest Questions

Editorial Team
  • 0
Editorial Team
Asked: May 23, 20262026-05-23T12:46:27+00:00 2026-05-23T12:46:27+00:00

I am attempting to work locally on a PHP application which I cloned from

  • 0

I am attempting to work locally on a PHP application which I cloned from the Git repository my partner and I use.

He uses a Mac, and until now I have been working on the app in a virtual Ubuntu Linux environment. Both environments have been able to use Compass polling with the same file structure and files.

On Windows 7, I run Compass commands from Cygwin, and this is the command I use to have Compass poll from the root directory of the app (C:/wamp/www/application):

compass watch --trace src/Application/ApplicationBundle/Resources/compass/

When I then make a change to a .scss file, I receive the following error:

ArgumentError on line 716 of /usr/lib/ruby/1.8/pathname.rb: different prefix: "/
/cygdrivecwampwwwlimelightsrclimelightlimelightbundleresourcescompasssrcpartials
_object.scss" and "/cygdrive/c/wamp/www/limelight/src/limelight/limelightbundle/
resources/compass/src"
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/path.rb:81:in 'split_path'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/path.rb:69:in 'run_callback'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/path.rb:55:in 'callback_action'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/path.rb:35:in 'update'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/state/directory.rb:39:in 'modified'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/state/directory.rb:37:in 'each'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/state/directory.rb:37:in 'modified'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/state/directory.rb:18:in 'refresh'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/backends/polling.rb:17:in 'run'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/backends/polling.rb:17:in 'each'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/backends/polling.rb:17:in 'run'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/backends/polling.rb:15:in 'loop'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/backends/polling.rb:15:in 'run'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm/monitor.rb:26:in 'run'
/usr/lib/ruby/gems/1.8/gems/fssm-0.2.7/lib/fssm.rb:20:in 'monitor'
/usr/lib/ruby/gems/1.8/gems/compass-0.11.1/lib/compass/commands/watch_project.rb:86:in 'perform'
/usr/lib/ruby/gems/1.8/gems/compass-0.11.1/lib/compass/commands/base.rb:18:in 'execute'
/usr/lib/ruby/gems/1.8/gems/compass-0.11.1/lib/compass/commands/project_base.rb:19:in 'execute'
/usr/lib/ruby/gems/1.8/gems/compass-0.11.1/lib/compass/exec/sub_command_ui.rb:43:in 'perform!'
/usr/lib/ruby/gems/1.8/gems/compass-0.11.1/lib/compass/exec/sub_command_ui.rb:15:in 'run!'
/usr/lib/ruby/gems/1.8/gems/compass-0.11.1/bin/compass:25
/usr/lib/ruby/gems/1.8/gems/compass-0.11.1/bin/compass:39:in 'call'
/usr/lib/ruby/gems/1.8/gems/compass-0.11.1/bin/compass:39
/usr/bin/compass:19:in 'load'
/usr/bin/compass:19

All I’ve been able to find through searching is that it may have something to do with the fact that Windows capitalizes its drive names, although the lack of slashes in the returned path makes me think the problem may be elsewhere.

Does anyone know why I might receive this error in Windows, but not other platforms?

NOTE: I have found a work-around involving installing ruby (and compass) through Windows’ command prompt rather than Cygwin, and that should work fine for now. Still, if anyone has ideas, I’m still curious as to what the problem could be.

  • 1 1 Answer
  • 0 Views
  • 0 Followers
  • 0
Share
  • Facebook
  • Report

Leave an answer
Cancel reply

You must login to add an answer.

Forgot Password?

Need An Account, Sign Up Here

1 Answer

  • Voted
  • Oldest
  • Recent
  • Random
  1. Editorial Team
    Editorial Team
    2026-05-23T12:46:28+00:00Added an answer on May 23, 2026 at 12:46 pm

    According to this commit, this is a problem caused by a compass dependency called FSSM. It is used to monitor file changes in compass. A workaround is described in this comment.

    It seems that FSSM detects that ruby is running inside a Windows box, and treats paths in the Windows’ way (C:\blabla). Commenting out the line 26 of the file <fssm_gem_path>/lib/fssm/pathname.rb makes compass watch work as expected. You can also add

    unless path[0, 1] == File::SEPARATOR
    

    to the end of line 26 to make it work.

    • 0
    • Reply
    • Share
      Share
      • Share on Facebook
      • Share on Twitter
      • Share on LinkedIn
      • Share on WhatsApp
      • Report

Sidebar

Related Questions

I'm attempting to make my networked application work locally (with both the server and
I am attempting to send the PrintScreen key, obviously, which ought to work no
Attempting to use the data series from this example no longer passes the JSONLint
I've attempting to develop a jQuery accordion, which is work ing pretty well so
I'm attempting to work with a legacy system which already has well-defined domain objects.
I'm attempting to use an UpdatePanel, but can't get partial-page updates to work. When
i'm attempting to make a purchase ordering system for work in php, mysql and
I'm attempting to use a custom Android vertical scrollbar widget that seems to work
I'm continuing to work out of an outdated bioinformatics book and I'm attempting to
Attempting to print out a list of values from 2 different variables that are

Explore

  • Home
  • Add group
  • Groups page
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Users
  • Help
  • SEARCH

Footer

© 2021 The Archive Base. All Rights Reserved
With Love by The Archive Base

Insert/edit link

Enter the destination URL

Or link to existing content

    No search term specified. Showing recent items. Search or use up and down arrow keys to select an item.