Sign Up

Sign Up to our social questions and Answers Engine to ask questions, answer people’s questions, and connect with other people.

Have an account? Sign In

Have an account? Sign In Now

Sign In

Login to our social questions & Answers Engine to ask questions answer people’s questions & connect with other people.

Sign Up Here

Forgot Password?

Don't have account, Sign Up Here

Forgot Password

Lost your password? Please enter your email address. You will receive a link and will create a new password via email.

Have an account? Sign In Now

You must login to ask a question.

Forgot Password?

Need An Account, Sign Up Here

Please briefly explain why you feel this question should be reported.

Please briefly explain why you feel this answer should be reported.

Please briefly explain why you feel this user should be reported.

Sign InSign Up

The Archive Base

The Archive Base Logo The Archive Base Logo

The Archive Base Navigation

  • Home
  • SEARCH
  • About Us
  • Blog
  • Contact Us
Search
Ask A Question

Mobile menu

Close
Ask a Question
  • Home
  • Add group
  • Groups page
  • Feed
  • User Profile
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Buy Points
  • Users
  • Help
  • Buy Theme
  • SEARCH
Home/ Questions/Q 218433
In Process

The Archive Base Latest Questions

Editorial Team
  • 0
Editorial Team
Asked: May 11, 20262026-05-11T18:45:02+00:00 2026-05-11T18:45:02+00:00

I am iterating through a file and on each line I am looking for

  • 0

I am iterating through a file and on each line I am looking for a regex. If the regex is found I just want to print “it’s found” and then the index location of where it was found in that line.

Example:

looking for: 'HDWFLSFKD' need index between two Ds
line: MLTSHQKKF*HDWFLSFKD*SNNYNSKQNHSIKDIFNRFNHYIYNDLGIRTIA
output: 'its found' index location: 10-17

The above ‘looking for’ is quite simple but I am planning to have complex regex statements in there.
So basically Just want to know if a regex is found in a string then how do we get the index location of it?

Here is the code I have so far:

foreach my $line (@file_data)
{
        if ($line=~ /HDWFLSFKD/){
            print "it's found\n"; 
            print "but at what index are the two Ds";
          }   
        else {
            $sequence.=$line;
            print "came in else\n";
        }
}
  • 1 1 Answer
  • 0 Views
  • 0 Followers
  • 0
Share
  • Facebook
  • Report

Leave an answer
Cancel reply

You must login to add an answer.

Forgot Password?

Need An Account, Sign Up Here

1 Answer

  • Voted
  • Oldest
  • Recent
  • Random
  1. Editorial Team
    Editorial Team
    2026-05-11T18:45:02+00:00Added an answer on May 11, 2026 at 6:45 pm

    I believe you are looking for pos:

     #!/usr/bin/perl
    
    use strict;
    use warnings;
    
    my $sequence;
    while (my $line = <DATA>) {
        if ($line=~ /(HDWFLSFKD)/g){
            print "its found index location: ", 
                pos($line)-length($1), "-",  pos($line), "\n";
        } else {
            $sequence .= $line;
            print "came in else\n";
        }
    }
    
    __DATA__
    MLTSHQKKF*HDWFLSFKD*SNNYNSKQNHSIKDIFNRFNHYIYNDLGIRTIA
    MLTSHQKKFSNNYNSKQNHSIKDIFNRFNHYIYNDLGIRTIA
    MLTSHQKKFSNNYNSK*HDWFLSFKD*QNHSIKDIFNRFNHYIYNDLGIRTIA
    

    You can also use the @- and @+ variables:

    #!/usr/bin/perl
    
    use strict;
    use warnings;
    
    my $sequence;
    while (my $line = <DATA>) {
            if ($line=~ /HDWFLSFKD/){
                    print "its found index location: $-[0]-$+[0]\n";
            } else {
                    $sequence .= $line;
                    print "came in else\n";
            }
    }
    
    __DATA__
    MLTSHQKKF*HDWFLSFKD*SNNYNSKQNHSIKDIFNRFNHYIYNDLGIRTIA
    MLTSHQKKFSNNYNSKQNHSIKDIFNRFNHYIYNDLGIRTIA
    MLTSHQKKFSNNYNSK*HDWFLSFKD*QNHSIKDIFNRFNHYIYNDL
    
    • 0
    • Reply
    • Share
      Share
      • Share on Facebook
      • Share on Twitter
      • Share on LinkedIn
      • Share on WhatsApp
      • Report

Sidebar

Ask A Question

Stats

  • Questions 271k
  • Answers 271k
  • Best Answers 0
  • User 1
  • Popular
  • Answers
  • Editorial Team

    How to approach applying for a job at a company ...

    • 7 Answers
  • Editorial Team

    How to handle personal stress caused by utterly incompetent and ...

    • 5 Answers
  • Editorial Team

    What is a programmer’s life like?

    • 5 Answers
  • Editorial Team
    Editorial Team added an answer Response.ContentType = "Application/pdf"; Response.AddHeader("content-disposition", "attachment;filename=" + fileNamn + ".pdf"); Response.BinaryWrite(dataPdf);… May 13, 2026 at 1:42 pm
  • Editorial Team
    Editorial Team added an answer Let's try to analyse them: C++ Pros: Generates native code,… May 13, 2026 at 1:41 pm
  • Editorial Team
    Editorial Team added an answer This is possibly the duplication of the following: How update… May 13, 2026 at 1:41 pm

Related Questions

I have an application that is made up of the following: A central database
I am brand new to python, and I need some help with the syntax
Do most (IE, FF, Safari, Chrome, Opera) make multiple HTTP Requests for a PDF
I'm trying to determine a file based on specific parameters. First, I am recursively

Trending Tags

analytics british company computer developers django employee employer english facebook french google interview javascript language life php programmer programs salary

Top Members

Explore

  • Home
  • Add group
  • Groups page
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Users
  • Help
  • SEARCH

Footer

© 2021 The Archive Base. All Rights Reserved
With Love by The Archive Base

Insert/edit link

Enter the destination URL

Or link to existing content

    No search term specified. Showing recent items. Search or use up and down arrow keys to select an item.