Sign Up

Sign Up to our social questions and Answers Engine to ask questions, answer people’s questions, and connect with other people.

Have an account? Sign In

Have an account? Sign In Now

Sign In

Login to our social questions & Answers Engine to ask questions answer people’s questions & connect with other people.

Sign Up Here

Forgot Password?

Don't have account, Sign Up Here

Forgot Password

Lost your password? Please enter your email address. You will receive a link and will create a new password via email.

Have an account? Sign In Now

You must login to ask a question.

Forgot Password?

Need An Account, Sign Up Here

Please briefly explain why you feel this question should be reported.

Please briefly explain why you feel this answer should be reported.

Please briefly explain why you feel this user should be reported.

Sign InSign Up

The Archive Base

The Archive Base Logo The Archive Base Logo

The Archive Base Navigation

  • Home
  • SEARCH
  • About Us
  • Blog
  • Contact Us
Search
Ask A Question

Mobile menu

Close
Ask a Question
  • Home
  • Add group
  • Groups page
  • Feed
  • User Profile
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Buy Points
  • Users
  • Help
  • Buy Theme
  • SEARCH
Home/ Questions/Q 6870397
In Process

The Archive Base Latest Questions

Editorial Team
  • 0
Editorial Team
Asked: May 27, 20262026-05-27T03:40:43+00:00 2026-05-27T03:40:43+00:00

I am thinking about a way to parse a fasta-file in parallel . For

  • 0

I am thinking about a way to parse a fasta-file in parallel. For those of you not knowing fasta-format an example:

>SEQUENCE_1  
MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG  
LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK  
IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL  
MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL  
>SEQUENCE_2  
SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI  
ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH  

So lines starting with an ‘>’ are header lines containing an identifier for the sequence following the identifier.

I suppose you load the entire file to memory but after this i am having trouble finding a way to process these data.

The problem is: Threads can not start at an arbitrary position because they could cut sequences this way.

Does someone has any experience in parsing files in parallel when the lines depend on each other? Any idea is appreciated.

  • 1 1 Answer
  • 0 Views
  • 0 Followers
  • 0
Share
  • Facebook
  • Report

Leave an answer
Cancel reply

You must login to add an answer.

Forgot Password?

Need An Account, Sign Up Here

1 Answer

  • Voted
  • Oldest
  • Recent
  • Random
  1. Editorial Team
    Editorial Team
    2026-05-27T03:40:44+00:00Added an answer on May 27, 2026 at 3:40 am

    Should be easy enough, since the dependence of lines on each other is very simple in this case: just make the threads start in an arbitrary position and then just skip the lines until they get to one that starts with a ‘>’ (i.e. starts a new sequence).

    To make sure no sequence gets processed twice, keep a set of all sequence IDs that have been processed (or you could do it by line number if the sequence IDs aren’t unique, but they really should be!).

    • 0
    • Reply
    • Share
      Share
      • Share on Facebook
      • Share on Twitter
      • Share on LinkedIn
      • Share on WhatsApp
      • Report

Sidebar

Related Questions

I have been thinking about the optimal way to create an XML file using
This recent question about sorting randomly using C# got me thinking about the way
Just thinking about the best way to build an Order form that would (from
I have been thinking about a neat way of load balancing and one thing
Maybe I'm thinking about this the wrong way but here's the idea: Class A
Thinking about getting into .net technology project management I've had plenty of experience with
Thinking about a Windows-hosted build process that will periodically drop files to disk to
Thinking about my other problem , i decided I can't even create a regular
Thinking about avoiding code replication, I got a question that catches me every time
Thinking about if we modify the definition of Hamiltonian path as we need to

Explore

  • Home
  • Add group
  • Groups page
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Users
  • Help
  • SEARCH

Footer

© 2021 The Archive Base. All Rights Reserved
With Love by The Archive Base

Insert/edit link

Enter the destination URL

Or link to existing content

    No search term specified. Showing recent items. Search or use up and down arrow keys to select an item.