Sign Up

Sign Up to our social questions and Answers Engine to ask questions, answer people’s questions, and connect with other people.

Have an account? Sign In

Have an account? Sign In Now

Sign In

Login to our social questions & Answers Engine to ask questions answer people’s questions & connect with other people.

Sign Up Here

Forgot Password?

Don't have account, Sign Up Here

Forgot Password

Lost your password? Please enter your email address. You will receive a link and will create a new password via email.

Have an account? Sign In Now

You must login to ask a question.

Forgot Password?

Need An Account, Sign Up Here

Please briefly explain why you feel this question should be reported.

Please briefly explain why you feel this answer should be reported.

Please briefly explain why you feel this user should be reported.

Sign InSign Up

The Archive Base

The Archive Base Logo The Archive Base Logo

The Archive Base Navigation

  • SEARCH
  • Home
  • About Us
  • Blog
  • Contact Us
Search
Ask A Question

Mobile menu

Close
Ask a Question
  • Home
  • Add group
  • Groups page
  • Feed
  • User Profile
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Buy Points
  • Users
  • Help
  • Buy Theme
  • SEARCH
Home/ Questions/Q 6474807
In Process

The Archive Base Latest Questions

Editorial Team
  • 0
Editorial Team
Asked: May 25, 20262026-05-25T06:37:53+00:00 2026-05-25T06:37:53+00:00

I have a text file with 50k+- lines and each line contains data which

  • 0

I have a text file with 50k+- lines and each line contains data which has to be pulled out of each line as a separate field.

The program runs several times a day.

Since this app is portable I am using SQLIite and reading each of those 50k lines one by one gathering required data and inserting into SQlite DB File as it goes.

I did some tests and found out reading through lines alone only takes like 10% of actual time it takes now, all the overhead comes when I am inserting all that data one by one in SQLite db.

Looking for suggestions for improvement.

  • 1 1 Answer
  • 0 Views
  • 0 Followers
  • 0
Share
  • Facebook
  • Report

Leave an answer
Cancel reply

You must login to add an answer.

Forgot Password?

Need An Account, Sign Up Here

1 Answer

  • Voted
  • Oldest
  • Recent
  • Random
  1. Editorial Team
    Editorial Team
    2026-05-25T06:37:53+00:00Added an answer on May 25, 2026 at 6:37 am

    You could increase performance using transactions, so that multiple INSERTs are requested at once, instead of one for each line in your text file. This would allow you to batch INSERT statements (try something like 100 per batch) – this will result in a significant performance boost.

    • 0
    • Reply
    • Share
      Share
      • Share on Facebook
      • Share on Twitter
      • Share on LinkedIn
      • Share on WhatsApp
      • Report

Sidebar

Related Questions

I have text file which contains lines as mentioned below <property>PASSWORD_X_1</property> <property>PASSWORD_A_2</property> <property>PASSWORD_B_6</property> so
I have text file from which I need to get data by line by
I have Text file that contains data separated with a comma , . How
I have text file(test.data), which include some values and class name, for example 4.5,3.5,U1
I have text file(test.data), which include(this is just example other files have more values....)
I have a text file with about 100,000 lines (5 MB), which is updated
I have text file (seq.fasta) which contains sequence as follows M1 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
I have a text file where each line is a list of arguments I
I have a text file which contains some locations of the files which I
I have text file with something like first line line nr 2 line three

Explore

  • Home
  • Add group
  • Groups page
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Users
  • Help
  • SEARCH

Footer

© 2021 The Archive Base. All Rights Reserved
With Love by The Archive Base

Insert/edit link

Enter the destination URL

Or link to existing content

    No search term specified. Showing recent items. Search or use up and down arrow keys to select an item.