Sign Up

Sign Up to our social questions and Answers Engine to ask questions, answer people’s questions, and connect with other people.

Have an account? Sign In

Have an account? Sign In Now

Sign In

Login to our social questions & Answers Engine to ask questions answer people’s questions & connect with other people.

Sign Up Here

Forgot Password?

Don't have account, Sign Up Here

Forgot Password

Lost your password? Please enter your email address. You will receive a link and will create a new password via email.

Have an account? Sign In Now

You must login to ask a question.

Forgot Password?

Need An Account, Sign Up Here

Please briefly explain why you feel this question should be reported.

Please briefly explain why you feel this answer should be reported.

Please briefly explain why you feel this user should be reported.

Sign InSign Up

The Archive Base

The Archive Base Logo The Archive Base Logo

The Archive Base Navigation

  • SEARCH
  • Home
  • About Us
  • Blog
  • Contact Us
Search
Ask A Question

Mobile menu

Close
Ask a Question
  • Home
  • Add group
  • Groups page
  • Feed
  • User Profile
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Buy Points
  • Users
  • Help
  • Buy Theme
  • SEARCH
Home/ Questions/Q 8027801
In Process

The Archive Base Latest Questions

Editorial Team
  • 0
Editorial Team
Asked: June 4, 20262026-06-04T23:55:13+00:00 2026-06-04T23:55:13+00:00

I use pairwise align to get the following: > alignment <-pairwiseAlignment(pattern = canonical.protein, subject=protein.extracted)

  • 0

I use pairwise align to get the following:

> alignment <-pairwiseAlignment(pattern = canonical.protein, subject=protein.extracted)
> alignment
Global PairwiseAlignedFixedSubject (1 of 1)
pattern: [448]          DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGV...FMVGRGYLSPDLSKVRSNCPKAMKRLMAE  CLKKKRDERPLFPQILASIELLARSLPK 
subject:   [1]     DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGV...FMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK 
score: -912.3752 

I can then use:

toString(pattern(alignment))
toString(subject(alignment)) 

to get the full string sequence for both the pattern and the subject. However, how do I get the number 448 and 1 out of the object as an integer? I need to use these numbers but there doesn’t seem to be a way to get at them.

  • 1 1 Answer
  • 0 Views
  • 0 Followers
  • 0
Share
  • Facebook
  • Report

Leave an answer
Cancel reply

You must login to add an answer.

Forgot Password?

Need An Account, Sign Up Here

1 Answer

  • Voted
  • Oldest
  • Recent
  • Random
  1. Editorial Team
    Editorial Team
    2026-06-04T23:55:15+00:00Added an answer on June 4, 2026 at 11:55 pm

    I believe these are the starts of the alignments, so

    start(pattern(alignment))
    

    Your question would be clearer with a fully reproducible example, e.g.,

    library(Biostrings)
    example(pairwiseAlignment)
    aln <- pairwiseAlignment(AAString("PAWHEAE"), AAString("HEAGAWGHEE"),
        substitutionMatrix = "BLOSUM50", gapOpening = 0, gapExtension = -8)
    

    Then

    > aln
    Global PairwiseAlignedFixedSubject (1 of 1)
    pattern: [1] PA--W-HEAE
    subject: [2] EAGAWGHE-E
    score: 1
    > start(subject(aln))
    [1] 2
    

    Also, the Bioconductor mailing list is more appropriate for these questions; no subscription required.

    • 0
    • Reply
    • Share
      Share
      • Share on Facebook
      • Share on Twitter
      • Share on LinkedIn
      • Share on WhatsApp
      • Report

Sidebar

Related Questions

use WWW::Mechanize; my $mech = WWW::Mechanize->new; $mech->get( $url ); say $mech->text; How could I
I use the following method to store all my correlations in a matrix: corrs
Use OPENXML to get dt element in MSSQL 2005. How can I get xmlns:dt
I have 13 matrices of various dimensions that i'd like to use in pairwise
use Image::Imlib2; my $a = Image::Imlib2->load(/foo/file); gives me the following error: Runtime error: Image::Imlib2
Use Case Show a photo uploaded by the user in a square box with
use C#,want to upload excel file on google doc. bellow syntax use to upload
use Text::Table; my $tb = Text::Table->new(Planet,Radius\nkm,Density\ng/cm^3); $tb->load( [ Mercury,2360,3.7], [ Mercury,2360,3.7], [ Mercury,2360,3.7], );
use strict; use warnings; use Time::HiRes qw(sleep); use Test::WWW::Selenium; use Test::More no_plan; use Test::Exception;
use the [] symbol in the name of the form field you are submitting

Explore

  • Home
  • Add group
  • Groups page
  • Communities
  • Questions
    • New Questions
    • Trending Questions
    • Must read Questions
    • Hot Questions
  • Polls
  • Tags
  • Badges
  • Users
  • Help
  • SEARCH

Footer

© 2021 The Archive Base. All Rights Reserved
With Love by The Archive Base

Insert/edit link

Enter the destination URL

Or link to existing content

    No search term specified. Showing recent items. Search or use up and down arrow keys to select an item.